Coming soon to Listen with Other, a new six-part story: TOMORROW NEVER KNOWS.
Episode 6 of 6. Bob and Dave finally crack the code and the typescript reveals the shocking conclusion the forgotten TV series never reached. It was written, read and mixed by Giles Booth who also arranged the opening Listen with Mother theme and synth version of ‘The Merry Month of Maying’. The choir version of Now is the Month of Maying was performed by the Tudor Choristers Virtual Choir, directed by Dr Kathleen McGuire and recorded in May 2020 during the Corona Virus lock down. Visit the Tudor Choristers at https://www.tudorchoristers.org.au/ The solo version of Now is the Month of Maying w
Episode 5 of 6. The Mind Children unexpectedly take the side of a school bully, and Bob and Dave get closer to cracking the code that will unlock the mystery of what happened to the forgotten TV show’s author. Original music by Lee Sparey. Script and audio mix © and ℗ 2026 Giles Booth. The cipher text mentioned in the show is as follows: LUDQCMSYFQGAAHEMXPCKYAYMIZSZZTGVTIQGZOKQKNKFSTDKBYMZQGSTLHQHSWWFCZOSIOKDPOIOYKQHKFUKPNIOZOHQFTGVCAGKYQHQCFHLPYFQAYTPFQLHACSGPUHINWKFHFZOHKXLFQLHTNACSTHQEFNWNITCDKKESGZOGQIHYKKFYNLTBNHRCFAYOIPLSXQBOSIOAYORQYAKSTZOFALOFVQHSWWFVYQXWIKGQYYOHAFEMVQGCFVYTDCKSNTINPIO
Episode 4 of 6. The Mind Children are back! Bob and Dave get their hands on a typescript of the unbroadcast final three episodes. In episode 4 The Mind Children conduct an experiment in social and mental engineering at the school Christmas fair. Original music by Lee Sparey. Script and audio mix © and ℗ 2026 Giles Booth. The cipher text mentioned in the show is as follows: LUDQCMSYFQGAAHEMXPCKYAYMIZSZZTGVTIQGZOKQKNKFSTDKBYMZQGSTLHQHSWWFCZOSIOKDPOIOYKQHKFUKPNIOZOHQFTGVCAGKYQHQCFHLPYFQAYTPFQLHACSGPUHINWKFHFZOHKXLFQLHTNACSTHQEFNWNITCDKKESGZOGQIHYKKFYNLTBNHRCFAYOIPLSXQBOSIOAYORQYAKSTZOFALOFVQHSWWF
Episode 3 of 6. Dave is contacted by a listener and drives to deepest Somerset on the trail of the elusive creator of The Mind Children. Original music by Lee Sparey. Script and audio mix © and ℗ 2026 Giles Booth.
Episode 2 of 6. Bob and Dave explore episode two of The Mind Children TV show, which tackled the subject of abuse at a boarding school. Then a listener contacts Dave with some extraordinary information about the series' enigmatic creator. Original music by Lee Sparey. Script and audio mix © and ℗ 2026 Giles Booth.
Episode 1 of 6. Bob and Dave are the only people who remember a lost 1970s children's TV show called The Mind Children. Reconnected after forty years by social media, the childhood friends start to investigate why it was cancelled after only three episodes, and what happened to its elusive creator. Original music by Lee Sparey. Script and audio mix © and ℗ 2026 Giles Booth.
Episode 6 of 6. As the big vote approaches, Kim makes a discovery about her family. Written, read and mixed by Giles Booth. Original music by Lee Sparey. © and ℗ 2026 Giles Booth.
Episode 5 of 6. It's Kim's birthday and Roland has an unusual gift for her. Written, read and mixed by Giles Booth. Original music by Lee Sparey. © and ℗ 2026 Giles Booth.
Episode 4 of 6. Roland helps Kim hatch a plan to escape the island using an ancient path across the mud. Written, read and mixed by Giles Booth. Original music by Lee Sparey. © and ℗ 2026 Giles Booth.
Episode 3 of 6. As Kim's stay on the island is extended she makes friends with two children who help her understand more about what's really going on, on the island and beyond. Written, read and mixed by Giles Booth. Original music by Lee Sparey. © and ℗ 2026 Giles Booth.
Episode 2 of 6. Kim arrives on the island, meets her grandfather who lives in the castle, and discovers the place is not quite as welcoming as she remembered it. Written, read and mixed by Giles Booth. Original music by Lee Sparey. © and ℗ 2026 Giles Booth.
Episode 1 of 6. Kim never knew her mother. She lives above the town bookshop with her father, dreaming of a time when rationing will end. When her father is called away, she is on the cusp of discovering more about her family, and the world around her. Written, read and mixed by Giles Booth. Original music by Lee Sparey. © and ℗ 2026 Giles Booth.
Episode 1 of 3. When Andrew's wife dies, he decides to take a short lease on a cottage in a fishing village in Cornwall to try to come to terms with his loss. He meets the curator of the eccentric local museum he and his wife had first discovered many years before. Cover image of Puck public domain, from Fun magazine, 2nd September 1865 via Hathi Trust. Written, read and mixed by Giles Booth. Original music by Lee Sparey. © and ℗ 2026 Giles Booth.
Episode 2 of 3. Andrew meets the museum's caretaker and discovers its most valuable asset. Written, read and mixed by Giles Booth. Original music by Lee Sparey. © and ℗ 2026 Giles Booth.
Episode 3 of 3. Andrew becomes obsessed with the ancient telegraph cable that lands on the beach and decides to see if it is still connected. Written, read and mixed by Giles Booth. Original music by Lee Sparey. © and ℗ 2026 Giles Booth.
Episode 1 of 3. Go back in time to the early 2000s when the staff of a tiny British computer company are struggling to produce a new personal digital assistant called the MagicSlate. Join these four conflicting forces on a team-building exercise which has unintended consequences in every direction. Written, read and mixed by Giles Booth. © and ℗ 2026 Giles Booth.
Episode 2 of 3. The four colleagues face their first team-building challenge of the day: work together to navigate a swamp. Theme music arranged by Giles Booth. Incidental music © Lee Sparey. Written, read and mixed by Giles Booth. © and ℗ 2026 Giles Booth.
Episode 3 of 3. Tempers fray as the four colleagues are split into two teams to embark on a treasure hunt. Theme music arranged by Giles Booth. Incidental music © Lee Sparey. Written, read and mixed by Giles Booth. © and ℗ 2026 Giles Booth.
Episode 1 of 1. Guest author Ray Newman, author of Municipal Gothic and Intervals of Darkness, reads a new story: The Interchange. Nobody knows who built the new exit road at Old Barn roundabout near the motorway interchange, when, or why. What is certain is that anybody who drives that way disappears. Every attempt by the authorities to investigate only raises more questions, and suggests new and more sinister possibilities. Story and original music © 2026 Ray Newman. Episode mix ℗ 2026 Giles Booth.
Episode 1 of 3. Enter the world of an enigmatic academic, hidden at the top of a dilapidated brutalist concrete university tower, a professor of paranormal computing, looking for patterns in random noise, and debunking stories of the unexplained. A persistent podcast researcher interrupts their near-solitude, leading to an investigation of a legend surrounding the fate of any student unlucky enough to be assigned room 623. Content warning: contains references to suicide.
Episode 2 of 3. The professor goes in search of the real room 623. Content warning: contains references to suicide.
Episode 3 of 3. The professor gets a wrong number. Is it a prank - or something more sinister? Content warning: contains references to suicide.
Episode 2 of 2. Two strangers attempt to unravel the mystery of the Ring O'Bells.
Episode 1 of 2. Discover how 1970s family Ouija board sessions come back to haunt our narrator in the present day.
